Plant Transcription Factor Database
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID cra_locus_5337_iso_4
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Gentianales; Apocynaceae; Rauvolfioideae; Vinceae; Catharanthinae; Catharanthus
Family TALE
Protein Properties Length: 739aa    MW: 80582.9 Da    PI: 5.0957
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
                                          --HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS
                             Homeobox  25 psaeereeLAkklgLterqVkvWFqNrRak 54 
                                          p+ +++  LA+++gLt +qV++WF N R +
  cra_locus_5337_iso_4_len_2919_ver_3 480 PKDSDKIMLARQTGLTRSQVSNWFINARVR 509
                                          77888899********************88 PP

                                 BELL   1 erqelqkkkakLlslleeVdkrYkqyveqlqtvissFeavaglgsakpYtslAlkaiSrhFrcLkdaiaeqi 72 
                                          e+q+lq+k +kL  +l+eV++rYkqy++q+q+v+ssF+ +ag g++kpYt+lAl++iSrhFrcL+dai+eq+
                                          6899******************************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005743.1E-59217366IPR006563POX domain
PfamPF075266.8E-49223365IPR006563POX domain
SMARTSM003890.0064463517IPR001356Homeobox domain
PfamPF059206.1E-11480509IPR008422Homeobox KN domain
CDDcd000864.19E-8480514No hitNo description
PROSITE profilePS500719.88480513IPR001356Homeobox domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 739 aa     Download sequence    Send to blast
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015892487.10.0PREDICTED: BEL1-like homeodomain protein 6
TrEMBLA0A068TL140.0A0A068TL14_COFCA; Uncharacterized protein